FLJ37543 antibody (N-Term)

Catalog No. ABIN631859

The Rabbit Polyclonal anti-FLJ37543 antibody has been validated for WB. It is suitable to detect FLJ37543 in samples from Human.

Quick Overview for FLJ37543 antibody (N-Term) (ABIN631859)

Target: FLJ37543 (Hypothetical Protein FLJ37543 (FLJ37543))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FLJ37543 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FLJ37543 Antibody

Binding Specificity: N-Term

Specificity: FLJ37543 antibody was raised against the N terminal of FLJ37543

Purification: Affinity purified

Immunogen: FLJ37543 antibody was raised using the N terminal of FLJ37543 corresponding to a region with amino acids MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ37543 Blocking Peptide, (ABIN5613614), is also available for use as a blocking control in assays to test for specificity of this FLJ37543 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ37543 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FLJ37543

Target: FLJ37543 (Hypothetical Protein FLJ37543 (FLJ37543))

Alternative Name: FLJ37543

Background: The function of FLJ37543 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 15 kDa (MW of target protein)