C21ORF45 antibody (N-Term)

Catalog No. ABIN631868

The Rabbit Polyclonal anti-C21ORF45 antibody is suitable to detect C21ORF45 in samples from Human. It has been validated for WB.

Quick Overview for C21ORF45 antibody (N-Term) (ABIN631868)

Target: C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C21ORF45 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C21ORF45 Antibody

Binding Specificity: N-Term

Specificity: C21 ORF45 antibody was raised against the N terminal Of C21 rf45

Purification: Affinity purified

Immunogen: C21 ORF45 antibody was raised using the N terminal Of C21 rf45 corresponding to a region with amino acids MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C21ORF45 Blocking Peptide, (ABIN5612489), is also available for use as a blocking control in assays to test for specificity of this C21ORF45 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C21ORF45

Target: C21ORF45 (MIS18A) (MIS18 Kinetochore Protein Homolog A (MIS18A))

Alternative Name: C21ORF45

Background: C21ORF45 is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.

Molecular Weight: 26 kDa (MW of target protein)