MORN4 antibody (Middle Region)

Catalog No. ABIN631870

This Rabbit Polyclonal antibody specifically detects MORN4 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for MORN4 antibody (Middle Region) (ABIN631870)

Target: MORN4 (MORN Repeat Containing 4 (MORN4))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MORN4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MORN4 Antibody

Binding Specificity: Middle Region

Specificity: C10 ORF83 antibody was raised against the middle region of C10 rf83

Purification: Affinity purified

Immunogen: C10 ORF83 antibody was raised using the middle region of C10 rf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10ORF83 Blocking Peptide, (ABIN938293), is also available for use as a blocking control in assays to test for specificity of this C10ORF83 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF83 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MORN4

Target: MORN4 (MORN Repeat Containing 4 (MORN4))

Alternative Name: C10ORF83

Background: The function of C10orf83 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 16 kDa (MW of target protein)