OSCP1 antibody (N-Term)

Catalog No. ABIN631871

The Rabbit Polyclonal anti-OSCP1 antibody has been validated for WB. It is suitable to detect OSCP1 in samples from Human, Mouse and Rat.

Quick Overview for OSCP1 antibody (N-Term) (ABIN631871)

Target: OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OSCP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OSCP1 Antibody

Binding Specificity: N-Term

Specificity: C1 ORF102 antibody was raised against the N terminal Of C1 rf102

Purification: Affinity purified

Immunogen: C1 ORF102 antibody was raised using the N terminal Of C1 rf102 corresponding to a region with amino acids MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF102 Blocking Peptide, (ABIN5612449), is also available for use as a blocking control in assays to test for specificity of this C1ORF102 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF102 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OSCP1

Target: OSCP1 (Organic Solute Carrier Partner 1 (OSCP1))

Alternative Name: C1ORF102

Background: C1ORF102 may be involved in drug clearance in the placenta.

Molecular Weight: 43 kDa (MW of target protein)