APOBEC4 antibody
-
- Target See all APOBEC4 Antibodies
- APOBEC4 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APOBEC4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ApoBEC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEKKKKKGK
- Top Product
- Discover our top product APOBEC4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ApoBEC4 Blocking Peptide, catalog no. 33R-9775, is also available for use as a blocking control in assays to test for specificity of this ApoBEC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOBEC4 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4))
- Alternative Name
- ApoBEC4 (APOBEC4 Products)
- Synonyms
- C1orf169 antibody, 4933431M11Rik antibody, apolipoprotein B mRNA editing enzyme catalytic polypeptide like 4 antibody, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative) antibody, APOBEC4 antibody, Apobec4 antibody
- Background
- APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.
- Molecular Weight
- 41 kDa (MW of target protein)
-