RPESP antibody (C-Term)

Catalog No. ABIN631879

This Rabbit Polyclonal antibody specifically detects RPESP in WB. It exhibits reactivity toward Mouse, Rat and Human.

Quick Overview for RPESP antibody (C-Term) (ABIN631879)

Target: RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))

Reactivity: Mouse, Rat, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPESP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPESP Antibody

Binding Specificity: C-Term

Specificity: RPESP antibody was raised against the C terminal of RPESP

Purification: Affinity purified

Immunogen: RPESP antibody was raised using the C terminal of RPESP corresponding to a region with amino acids WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC

Application Details

Application Notes: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPESP Blocking Peptide, (ABIN5615933), is also available for use as a blocking control in assays to test for specificity of this RPESP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPESP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPESP

Target: RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))

Alternative Name: RPESP

Background: RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.

Molecular Weight: 29 kDa (MW of target protein)