RPL10A antibody (N-Term)

Catalog No. ABIN631884

This anti-RPL10A antibody is a Rabbit Polyclonal antibody detecting RPL10A in WB. Suitable for Human.

Quick Overview for RPL10A antibody (N-Term) (ABIN631884)

Target: RPL10A (Ribosomal Protein L10a (RPL10A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL10A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPL10A Antibody

Binding Specificity: N-Term

Specificity: RPL10 A antibody was raised against the N terminal of RPL10

Purification: Affinity purified

Immunogen: RPL10 A antibody was raised using the N terminal of RPL10 corresponding to a region with amino acids MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL10A Blocking Peptide, (ABIN5615935), is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL10A

Target: RPL10A (Ribosomal Protein L10a (RPL10A))

Alternative Name: RPL10A

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development.

Molecular Weight: 25 kDa (MW of target protein)