RPL10A antibody (N-Term)
-
- Target See all RPL10A Antibodies
- RPL10A (Ribosomal Protein L10a (RPL10A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPL10A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPL10 A antibody was raised against the N terminal of RPL10
- Purification
- Affinity purified
- Immunogen
- RPL10 A antibody was raised using the N terminal of RPL10 corresponding to a region with amino acids MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS
- Top Product
- Discover our top product RPL10A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPL10A Blocking Peptide, catalog no. 33R-6498, is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPL10A (Ribosomal Protein L10a (RPL10A))
- Alternative Name
- RPL10A (RPL10A Products)
- Background
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development.
- Molecular Weight
- 25 kDa (MW of target protein)
-