PGLS antibody (Middle Region)

Catalog No. ABIN631885

Product Details anti-PGLS Antibody

Target: PGLS (6-phosphogluconolactonase (PGLS))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PGLS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PGLS antibody was raised against the middle region of PGLS

Purification: Affinity purified

Immunogen: PGLS antibody was raised using the middle region of PGLS corresponding to a region with amino acids AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGLS Blocking Peptide, catalog no. 33R-1059, is also available for use as a blocking control in assays to test for specificity of this PGLS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGLS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PGLS

Target: PGLS (6-phosphogluconolactonase (PGLS))

Alternative Name: PGLS (PGLS Products)

Synonyms: 6PGL antibody, PGLS antibody, PSPTO1301 antibody, 1110030K05Rik antibody, AI447866 antibody, Plgs antibody, 6-phosphogluconolactonase antibody, PGLS antibody, pgl antibody, CND03390 antibody, CNE04030 antibody, Tb11.02.4200 antibody, Pgls antibody

Background: PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.

Molecular Weight: 28 kDa (MW of target protein)