PYCR2 antibody (C-Term)

Catalog No. ABIN631887

This anti-PYCR2 antibody is a Rabbit Polyclonal antibody detecting PYCR2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for PYCR2 antibody (C-Term) (ABIN631887)

Target: PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PYCR2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PYCR2 Antibody

Binding Specificity: C-Term

Specificity: PYCR2 antibody was raised against the C terminal of PYCR2

Purification: Affinity purified

Immunogen: PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PYCR2 Blocking Peptide, (ABIN940441), is also available for use as a blocking control in assays to test for specificity of this PYCR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PYCR2

Target: PYCR2 (Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2))

Alternative Name: PYCR2

Background: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

Molecular Weight: 34 kDa (MW of target protein)