C21orf91 antibody (Middle Region)

Catalog No. ABIN631903

Product Details anti-C21orf91 Antibody

Target: C21orf91 (Chromosome 21 Open Reading Frame 91 (C21orf91))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C21orf91 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C21 ORF91 antibody was raised against the middle region of C21 rf91

Purification: Affinity purified

Immunogen: C21 ORF91 antibody was raised using the middle region of C21 rf91 corresponding to a region with amino acids LCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C21ORF91 Blocking Peptide, catalog no. 33R-4830, is also available for use as a blocking control in assays to test for specificity of this C21ORF91 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF91 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C21orf91

Target: C21orf91 (Chromosome 21 Open Reading Frame 91 (C21orf91))

Alternative Name: C21ORF91 (C21orf91 Products)

Synonyms: C21orf14 antibody, C21orf38 antibody, CSSG1 antibody, EURL antibody, YG81 antibody, C21orf91 antibody, 1700010I10Rik antibody, 2310009O17Rik antibody, E330003K22Rik antibody, Eurl antibody, eurl antibody, chromosome 21 open reading frame 91 antibody, chromosome 1 open reading frame, human C21orf91 antibody, chromosome 3 open reading frame, human C21orf91 antibody, chromosome 21 open reading frame 91 L homeolog antibody, DNA segment, Chr 16, ERATO Doi 472, expressed antibody, zgc:110006 antibody, C21orf91 antibody, C1H21ORF91 antibody, C3H21orf91 antibody, c21orf91.L antibody, c21orf91 antibody, C1H21orf91 antibody, D16Ertd472e antibody, zgc:110006 antibody

Background: The function of C21orf91 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 34 kDa (MW of target protein)