ASPA antibody

Catalog No. ABIN631906

Product Details anti-ASPA Antibody

Target: ASPA (Aspartoacylase (ASPA))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASPA antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ASPA antibody was raised using a synthetic peptide corresponding to a region with amino acids RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASPA Blocking Peptide, catalog no. 33R-7964, is also available for use as a blocking control in assays to test for specificity of this ASPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASPA

Target: ASPA (Aspartoacylase (ASPA))

Alternative Name: ASPA (ASPA Products)

Synonyms: asp antibody, acy2 antibody, ACY-2 antibody, ASP antibody, ACY2 antibody, Acy-2 antibody, Acy2 antibody, nur7 antibody, zgc:171507 antibody, aspartoacylase antibody, Aspartoacylase antibody, ASPA antibody, aspa antibody, Fbal_2465 antibody, Aspa antibody

Background: The specific function of SASP is not yet known.

Molecular Weight: 36 kDa (MW of target protein)