MAGEA3 antibody (Middle Region)
-
- Target See all MAGEA3 Antibodies
- MAGEA3 (Melanoma Antigen Family A, 3 (MAGEA3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAGEA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAGEA3 antibody was raised against the middle region of MAGEA3
- Purification
- Affinity purified
- Immunogen
- MAGEA3 antibody was raised using the middle region of MAGEA3 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD
- Top Product
- Discover our top product MAGEA3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAGEA3 Blocking Peptide, catalog no. 33R-1420, is also available for use as a blocking control in assays to test for specificity of this MAGEA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEA3 (Melanoma Antigen Family A, 3 (MAGEA3))
- Alternative Name
- MAGEA3 (MAGEA3 Products)
- Background
- MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.
- Molecular Weight
- 35 kDa (MW of target protein)
-