HMBS antibody (N-Term)

Catalog No. ABIN631916

The Rabbit Polyclonal anti-HMBS antibody has been validated for WB. It is suitable to detect HMBS in samples from Human.

Quick Overview for HMBS antibody (N-Term) (ABIN631916)

Target: HMBS (Hydroxymethylbilane Synthase (HMBS))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HMBS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HMBS Antibody

Binding Specificity: N-Term

Specificity: HMBS antibody was raised against the N terminal of HMBS

Purification: Affinity purified

Immunogen: HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HMBS Blocking Peptide, (ABIN5614024), is also available for use as a blocking control in assays to test for specificity of this HMBS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMBS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HMBS

Target: HMBS (Hydroxymethylbilane Synthase (HMBS))

Alternative Name: HMBS

Background: HMBS is a member of the hydroxymethylbilane synthase superfamily. It is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria.

Molecular Weight: 38 kDa (MW of target protein)