PFDN6 antibody (N-Term)

Catalog No. ABIN631922

The Rabbit Polyclonal anti-PFDN6 antibody has been validated for WB. It is suitable to detect PFDN6 in samples from Human, Mouse, Rat and Dog.

Quick Overview for PFDN6 antibody (N-Term) (ABIN631922)

Target: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PFDN6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PFDN6 Antibody

Binding Specificity: N-Term

Specificity: PFDN6 antibody was raised against the N terminal of PFDN6

Purification: Affinity purified

Immunogen: PFDN6 antibody was raised using the N terminal of PFDN6 corresponding to a region with amino acids MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PFDN6 Blocking Peptide, (ABIN5615323), is also available for use as a blocking control in assays to test for specificity of this PFDN6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFDN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PFDN6

Target: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Alternative Name: PFDN6

Background: PFDN6 binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. PFDN6 binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Unfolded Protein Response