TTC12 antibody (C-Term)

Catalog No. ABIN631929

This anti-TTC12 antibody is a Rabbit Polyclonal antibody detecting TTC12 in WB. Suitable for Human and Rat.

Quick Overview for TTC12 antibody (C-Term) (ABIN631929)

Target: TTC12 (Tetratricopeptide Repeat Domain 12 (TTC12))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TTC12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TTC12 Antibody

Binding Specificity: C-Term

Specificity: TTC12 antibody was raised against the C terminal of TTC12

Purification: Affinity purified

Immunogen: TTC12 antibody was raised using the C terminal of TTC12 corresponding to a region with amino acids MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TTC12 Blocking Peptide, (ABIN5616834), is also available for use as a blocking control in assays to test for specificity of this TTC12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TTC12

Target: TTC12 (Tetratricopeptide Repeat Domain 12 (TTC12))

Alternative Name: TTC12

Background: TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.

Molecular Weight: 81 kDa (MW of target protein)