FKBPL antibody (N-Term)

Catalog No. ABIN631941

This anti-FKBPL antibody is a Rabbit Polyclonal antibody detecting FKBPL in WB. Suitable for Human.

Quick Overview for FKBPL antibody (N-Term) (ABIN631941)

Target: FKBPL (FK506 Binding Protein Like (FKBPL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FKBPL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FKBPL Antibody

Binding Specificity: N-Term

Specificity: FKBPL antibody was raised against the N terminal of FKBPL

Purification: Affinity purified

Immunogen: FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FKBPL Blocking Peptide, (ABIN5613598), is also available for use as a blocking control in assays to test for specificity of this FKBPL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBPL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FKBPL

Target: FKBPL (FK506 Binding Protein Like (FKBPL))

Alternative Name: FKBPL

Background: The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking.

Molecular Weight: 38 kDa (MW of target protein)