PARP12 antibody

Catalog No. ABIN631944

This anti-PARP12 antibody is a Rabbit Polyclonal antibody detecting PARP12 in WB. Suitable for Human.

Quick Overview for PARP12 antibody (ABIN631944)

Target: PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARP12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PARP12 Antibody

Purification: Affinity purified

Immunogen: PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARP12 Blocking Peptide, (ABIN938520), is also available for use as a blocking control in assays to test for specificity of this PARP12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARP12

Target: PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))

Alternative Name: PARP12

Background: The function of PARP12 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 79 kDa (MW of target protein)