ZCCHC24 antibody (Middle Region)

Catalog No. ABIN631945

This Rabbit Polyclonal antibody specifically detects ZCCHC24 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ZCCHC24 antibody (Middle Region) (ABIN631945)

Target: ZCCHC24 (Zinc Finger, CCHC Domain Containing 24 (ZCCHC24))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZCCHC24 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZCCHC24 Antibody

Binding Specificity: Middle Region

Specificity: C10 ORF56 antibody was raised against the middle region of C10 rf56

Purification: Affinity purified

Immunogen: C10 ORF56 antibody was raised using the middle region of C10 rf56 corresponding to a region with amino acids LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10ORF56 Blocking Peptide, (ABIN5612384), is also available for use as a blocking control in assays to test for specificity of this C10ORF56 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZCCHC24

Target: ZCCHC24 (Zinc Finger, CCHC Domain Containing 24 (ZCCHC24))

Alternative Name: C10ORF56

Background: C10orf56 is probably involved in oxidoreductase activity.

Molecular Weight: 27 kDa (MW of target protein)