ASCC2 antibody (Middle Region)

Catalog No. ABIN631946

The Rabbit Polyclonal anti-ASCC2 antibody has been validated for WB. It is suitable to detect ASCC2 in samples from Human, Mouse and Rat.

Quick Overview for ASCC2 antibody (Middle Region) (ABIN631946)

Target: ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASCC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ASCC2 Antibody

Binding Specificity: Middle Region

Specificity: ASCC2 antibody was raised against the middle region of ASCC2

Purification: Affinity purified

Immunogen: ASCC2 antibody was raised using the middle region of ASCC2 corresponding to a region with amino acids YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASCC2 Blocking Peptide, (ABIN936042), is also available for use as a blocking control in assays to test for specificity of this ASCC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASCC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASCC2

Target: ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2))

Alternative Name: ASCC2

Background: ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation.

Molecular Weight: 86 kDa (MW of target protein)