ANKRD2 antibody

Catalog No. ABIN631951

This Rabbit Polyclonal antibody specifically detects ANKRD2 in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for ANKRD2 antibody (ABIN631951)

Target: ANKRD2 (Ankyrin Repeat Domain 2 (Stretch Responsive Muscle) (ANKRD2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ANKRD2 Antibody

Purification: Affinity purified

Immunogen: ANKRD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD2 Blocking Peptide, (ABIN5612064), is also available for use as a blocking control in assays to test for specificity of this ANKRD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD2

Target: ANKRD2 (Ankyrin Repeat Domain 2 (Stretch Responsive Muscle) (ANKRD2))

Alternative Name: ANKRD2

Background: ANKRD2 may play an important role in skeletal muscle hypertrophy.

Molecular Weight: 49 kDa (MW of target protein)