MDH1B antibody

Catalog No. ABIN631954

This Rabbit Polyclonal antibody specifically detects MDH1B in WB. It exhibits reactivity toward Human.

Quick Overview for MDH1B antibody (ABIN631954)

Target: MDH1B (Malate Dehydrogenase 1B, NAD (Soluble) (MDH1B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MDH1B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MDH1B Antibody

Purification: Affinity purified

Immunogen: MDH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MDH1B Blocking Peptide, (ABIN936191), is also available for use as a blocking control in assays to test for specificity of this MDH1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MDH1B

Target: MDH1B (Malate Dehydrogenase 1B, NAD (Soluble) (MDH1B))

Alternative Name: MDH1B

Background: The function of MDH1B protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 59 kDa (MW of target protein)