ADH5 antibody

Catalog No. ABIN631955

The Rabbit Polyclonal anti-ADH5 antibody has been validated for WB. It is suitable to detect ADH5 in samples from Human.

Quick Overview for ADH5 antibody (ABIN631955)

Target: ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADH5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADH5 Antibody

Purification: Affinity purified

Immunogen: ADH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADH5 Blocking Peptide, (ABIN940053), is also available for use as a blocking control in assays to test for specificity of this ADH5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADH5

Target: ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))

Alternative Name: ADH5

Background: This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.

Molecular Weight: 40 kDa (MW of target protein)