TPD52 antibody (Middle Region)

Catalog No. ABIN631964

The Rabbit Polyclonal anti-TPD52 antibody has been validated for WB. It is suitable to detect TPD52 in samples from Human, Mouse and Rat.

Quick Overview for TPD52 antibody (Middle Region) (ABIN631964)

Target: TPD52 (Tumor Protein D52 (TPD52))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPD52 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TPD52 Antibody

Binding Specificity: Middle Region

Specificity: TPD52 antibody was raised against the middle region of TPD52

Purification: Affinity purified

Immunogen: TPD52 antibody was raised using the middle region of TPD52 corresponding to a region with amino acids AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPD52 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TPD52 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPD52 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPD52

Target: TPD52 (Tumor Protein D52 (TPD52))

Alternative Name: TPD52

Background: TPD52 belongs to the TPD52 family. Its exact function remains unknown.

Molecular Weight: 24 kDa (MW of target protein)