FAM76B antibody (Middle Region)

Catalog No. ABIN631968

Product Details anti-FAM76B Antibody

Target: FAM76B (Family with Sequence Similarity 76, Member B (FAM76B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM76B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM76 B antibody was raised against the middle region of FAM76

Purification: Affinity purified

Immunogen: FAM76 B antibody was raised using the middle region of FAM76 corresponding to a region with amino acids QQCAFDRKEEGRRKVDGKLLCWLCTLSYKRVLQKTKEQRKSLGSSHSNSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM76B Blocking Peptide, catalog no. 33R-7689, is also available for use as a blocking control in assays to test for specificity of this FAM76B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM76B

Target: FAM76B (Family with Sequence Similarity 76, Member B (FAM76B))

Alternative Name: FAM76B (FAM76B Products)

Synonyms: fa11h02 antibody, wu:fa11h02 antibody, zgc:73333 antibody, 2810485I05Rik antibody, C78303 antibody, RGD1311077 antibody, family with sequence similarity 76 member B antibody, family with sequence similarity 76, member B antibody, family with sequence similarity 76 member B S homeolog antibody, FAM76B antibody, fam76b antibody, fam76b.S antibody, Fam76b antibody

Background: FAM76B belongs to the FAM76 family. The function of the FAM76B protein remains unknown.

Molecular Weight: 39 kDa (MW of target protein)