NOB1 antibody

Catalog No. ABIN631975

This Rabbit Polyclonal antibody specifically detects NOB1 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for NOB1 antibody (ABIN631975)

Target: NOB1 (RNA-Binding Protein NOB1 (NOB1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NOB1 Antibody

Purification: Affinity purified

Immunogen: NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOB1 Blocking Peptide, (ABIN5615016), is also available for use as a blocking control in assays to test for specificity of this NOB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOB1

Target: NOB1 (RNA-Binding Protein NOB1 (NOB1))

Alternative Name: NOB1

Background: NOB1 may play a role in mRNA degradation.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus