ZADH2 antibody (N-Term)

Catalog No. ABIN631977

This anti-ZADH2 antibody is a Rabbit Polyclonal antibody detecting ZADH2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ZADH2 antibody (N-Term) (ABIN631977)

Target: ZADH2 (Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZADH2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZADH2 Antibody

Binding Specificity: N-Term

Specificity: ZADH2 antibody was raised against the N terminal of ZADH2

Purification: Affinity purified

Immunogen: ZADH2 antibody was raised using the N terminal of ZADH2 corresponding to a region with amino acids FVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZADH2 Blocking Peptide, (ABIN938500), is also available for use as a blocking control in assays to test for specificity of this ZADH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZADH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZADH2

Target: ZADH2 (Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2))

Alternative Name: ZADH2

Background: The function of ZADH2 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 43 kDa (MW of target protein)