PRR16 antibody (Middle Region)

Catalog No. ABIN631986

Product Details anti-PRR16 Antibody

Target: PRR16 (Proline Rich 16 (PRR16))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRR16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRR16 antibody was raised against the middle region of PRR16

Purification: Affinity purified

Immunogen: PRR16 antibody was raised using the middle region of PRR16 corresponding to a region with amino acids RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRR16 Blocking Peptide, catalog no. 33R-7888, is also available for use as a blocking control in assays to test for specificity of this PRR16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRR16

Target: PRR16 (Proline Rich 16 (PRR16))

Alternative Name: PRR16 (PRR16 Products)

Synonyms: DSC54 antibody, 5430406M13Rik antibody, AI607429 antibody, RGD1564528 antibody, proline rich 16 antibody, PRR16 antibody, prr16 antibody, Prr16 antibody

Background: The function of PRR16 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 30 kDa (MW of target protein)