Pellino 1 antibody
-
- Target See all Pellino 1 (PELI1) Antibodies
- Pellino 1 (PELI1) (Pellino E3 Ubiquitin Protein Ligase 1 (PELI1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Pellino 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA
- Top Product
- Discover our top product PELI1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PELI1 Blocking Peptide, catalog no. 33R-2740, is also available for use as a blocking control in assays to test for specificity of this PELI1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PELI1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pellino 1 (PELI1) (Pellino E3 Ubiquitin Protein Ligase 1 (PELI1))
- Alternative Name
- PELI1 (PELI1 Products)
- Background
- PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Toll-Like Receptors Cascades
-