C11orf54 antibody (N-Term)

Catalog No. ABIN632029

This Rabbit Polyclonal antibody specifically detects C11orf54 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for C11orf54 antibody (N-Term) (ABIN632029)

Target: C11orf54 (Chromosome 11 Open Reading Frame 54 (C11orf54))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C11orf54 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C11orf54 Antibody

Binding Specificity: N-Term

Specificity: C11 ORF54 antibody was raised against the N terminal Of C11 rf54

Purification: Affinity purified

Immunogen: C11 ORF54 antibody was raised using the N terminal Of C11 rf54 corresponding to a region with amino acids CPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C11ORF54 Blocking Peptide, (ABIN937145), is also available for use as a blocking control in assays to test for specificity of this C11ORF54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C11orf54

Target: C11orf54 (Chromosome 11 Open Reading Frame 54 (C11orf54))

Alternative Name: C11ORF54

Background: C11orf54 exhibits ester hydrolase activity on the substrate p-nitrophenyl acetate.

Molecular Weight: 29 kDa (MW of target protein)