KIF5C antibody (N-Term)

Catalog No. ABIN632038

This Rabbit Polyclonal antibody specifically detects KIF5C in WB. It exhibits reactivity toward Mouse, Human and Rat.

Quick Overview for KIF5C antibody (N-Term) (ABIN632038)

Target: KIF5C (Kinesin Family Member 5C (KIF5C))

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF5C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KIF5C Antibody

Binding Specificity: N-Term

Specificity: KIF5 C antibody was raised against the N terminal of KIF5

Purification: Affinity purified

Immunogen: KIF5 C antibody was raised using the N terminal of KIF5 corresponding to a region with amino acids TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF5C Blocking Peptide, (ABIN5614354), is also available for use as a blocking control in assays to test for specificity of this KIF5C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF5C

Target: KIF5C (Kinesin Family Member 5C (KIF5C))

Alternative Name: KIF5C

Background: KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

Molecular Weight: 109 kDa (MW of target protein)