Phosphoglucomutase 1 antibody (Middle Region)

Catalog No. ABIN632042

Product Details anti-Phosphoglucomutase 1 Antibody

Target: Phosphoglucomutase 1 (PGM1)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Phosphoglucomutase 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PGM1 antibody was raised against the middle region of PGM1

Purification: Affinity purified

Immunogen: PGM1 antibody was raised using the middle region of PGM1 corresponding to a region with amino acids ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGM1 Blocking Peptide, catalog no. 33R-1559, is also available for use as a blocking control in assays to test for specificity of this PGM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Phosphoglucomutase 1

Target: Phosphoglucomutase 1 (PGM1)

Alternative Name: PGM1 (PGM1 Products)

Background: PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process