Phosphoglucomutase 1 antibody (Middle Region)
-
- Target See all Phosphoglucomutase 1 (PGM1) Antibodies
- Phosphoglucomutase 1 (PGM1)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Phosphoglucomutase 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PGM1 antibody was raised against the middle region of PGM1
- Purification
- Affinity purified
- Immunogen
- PGM1 antibody was raised using the middle region of PGM1 corresponding to a region with amino acids ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI
- Top Product
- Discover our top product PGM1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PGM1 Blocking Peptide, catalog no. 33R-1559, is also available for use as a blocking control in assays to test for specificity of this PGM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Phosphoglucomutase 1 (PGM1)
- Alternative Name
- PGM1 (PGM1 Products)
- Synonyms
- CDG1T antibody, GSD14 antibody, ARABIDOPSIS THALIANA PHOSPHOGLUCOMUTASE antibody, ATPGMP antibody, MIO24.4 antibody, MIO24_4 antibody, PGM1 antibody, PHOSPHOGLUCOMUTASE antibody, STARCH-FREE 1 antibody, STF1 antibody, phosphoglucomutase antibody, PSPTO3035 antibody, CMS0426 antibody, 3230402E02Rik antibody, Pgm-1 antibody, Pgm2 antibody, zgc:63718 antibody, phosphoglucomutase-1 antibody, pgm2 antibody, PGM antibody, PGM 1 antibody, phosphoglucomutase 1 antibody, hypothetical protein antibody, phosphoglucomutase antibody, phosphoglucomutase alpha-D-glucose phosphate-specific Pgm antibody, phosphoglucomutase, alpha-D-glucose phosphate-specific antibody, phosphoglucomutase 1 L homeolog antibody, PGM1 antibody, R05F9.6 antibody, PGM antibody, pgm antibody, STY0736 antibody, PMI_RS02700 antibody, Pgm1 antibody, pgm1 antibody, LOC542721 antibody, pgm1.L antibody
- Background
- PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-