EFHA2 antibody (N-Term)

Catalog No. ABIN632049

This anti-EFHA2 antibody is a Rabbit Polyclonal antibody detecting EFHA2 in WB. Suitable for Human.

Quick Overview for EFHA2 antibody (N-Term) (ABIN632049)

Target: EFHA2 (MICU3) (Mitochondrial Calcium Uptake Family, Member 3 (MICU3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EFHA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EFHA2 Antibody

Binding Specificity: N-Term

Specificity: EFHA2 antibody was raised against the N terminal of EFHA2

Purification: Affinity purified

Immunogen: EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EFHA2 Blocking Peptide, (ABIN5613313), is also available for use as a blocking control in assays to test for specificity of this EFHA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFHA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EFHA2

Target: EFHA2 (MICU3) (Mitochondrial Calcium Uptake Family, Member 3 (MICU3))

Alternative Name: EFHA2

Background: The function of EFHA protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 61 kDa (MW of target protein)