Ubiquilin 1 antibody (Middle Region)

Catalog No. ABIN632051

Product Details anti-Ubiquilin 1 Antibody

Target: Ubiquilin 1 (UBQLN1)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ubiquilin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Ubiquilin 1 antibody was raised against the middle region of UBQLN1

Purification: Affinity purified

Immunogen: Ubiquilin 1 antibody was raised using the middle region of UBQLN1 corresponding to a region with amino acids QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ubiquilin 1 Blocking Peptide, catalog no. 33R-7544, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ubiquilin 1

Target: Ubiquilin 1 (UBQLN1)

Alternative Name: Ubiquilin 1 (UBQLN1 Products)

Synonyms: UBQLN1 antibody, DA41 antibody, DSK2 antibody, PLIC-1 antibody, UBQN antibody, XDRP1 antibody, 1110046H03Rik antibody, 1810030E05Rik antibody, AU019746 antibody, C77538 antibody, D13Ertd372e antibody, Da41 antibody, Dsk2 antibody, Plic-1 antibody, Plic1 antibody, Xdrp1 antibody, ubiquilin 1 antibody, UBQLN1 antibody, Ubqln1 antibody

Background: UBQLN1 is an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.

Molecular Weight: 62 kDa (MW of target protein)