LDHD antibody (Middle Region)

Catalog No. ABIN632075

Product Details anti-LDHD Antibody

Target: LDHD (Lactate Dehydrogenase D (LDHD))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LDHD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LDHD antibody was raised against the middle region of LDHD

Purification: Affinity purified

Immunogen: LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LDHD Blocking Peptide, catalog no. 33R-5196, is also available for use as a blocking control in assays to test for specificity of this LDHD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LDHD

Target: LDHD (Lactate Dehydrogenase D (LDHD))

Alternative Name: LDHD (LDHD Products)

Synonyms: DLD antibody, 4733401P21Rik antibody, D8Bwg1320e antibody, Ac2-202 antibody, lactate dehydrogenase D antibody, LDHD antibody, ldhd antibody, Ldhd antibody

Background: The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process