C9orf153 antibody (Middle Region)

Catalog No. ABIN632076

This anti-C9orf153 antibody is a Rabbit Polyclonal antibody detecting C9orf153 in WB. Suitable for Human.

Quick Overview for C9orf153 antibody (Middle Region) (ABIN632076)

Target: C9orf153 (Chromosome 9 Open Reading Frame 153 (C9orf153))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C9orf153 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C9orf153 Antibody

Binding Specificity: Middle Region

Specificity: C9 ORF153 antibody was raised against the middle region of C9 rf153

Purification: Affinity purified

Immunogen: C9 ORF153 antibody was raised using the middle region of C9 rf153 corresponding to a region with amino acids NEAQEVLARNLNVMSFTRGADVRGDLQPVISVNKMNKPGKHRKTPSPKIN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C9ORF153 Blocking Peptide, (ABIN5612547), is also available for use as a blocking control in assays to test for specificity of this C9ORF153 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF153 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C9orf153

Target: C9orf153 (Chromosome 9 Open Reading Frame 153 (C9orf153))

Alternative Name: C9ORF153

Background: The function of C9orf153 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 29 kDa (MW of target protein)