C12orf4 antibody (N-Term)

Catalog No. ABIN632079

This anti-C12orf4 antibody is a Rabbit Polyclonal antibody detecting C12orf4 in WB. Suitable for Human.

Quick Overview for C12orf4 antibody (N-Term) (ABIN632079)

Target: C12orf4 (Chromosome 12 Open Reading Frame 4 (C12orf4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C12orf4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C12orf4 Antibody

Binding Specificity: N-Term

Specificity: C12 ORF4 antibody was raised against the N terminal Of C12 rf4

Purification: Affinity purified

Immunogen: C12 ORF4 antibody was raised using the N terminal Of C12 rf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C12ORF4 Blocking Peptide, (ABIN937776), is also available for use as a blocking control in assays to test for specificity of this C12ORF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C12orf4

Target: C12orf4 (Chromosome 12 Open Reading Frame 4 (C12orf4))

Alternative Name: C12ORF4

Background: The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 64 kDa (MW of target protein)