ZGPAT antibody (C-Term)
Quick Overview for ZGPAT antibody (C-Term) (ABIN632083)
Target
See all ZGPAT AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- C-Term
-
Specificity
- ZGPAT antibody was raised against the C terminal of ZGPAT
-
Purification
- Affinity purified
-
Immunogen
- ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
-
-
-
-
Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Comment
-
ZGPAT Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ZGPAT antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZGPAT antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Storage
- 4 °C/-20 °C
-
Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- ZGPAT (Zinc Finger, CCCH-Type with G Patch Domain (ZGPAT))
-
Alternative Name
- ZGPAT
-
Background
- ZGPAT contains 1 C3H1-type zinc finger and 1 G-patch domain. The function of the ZGPAT protein is not known.
-
Molecular Weight
- 57 kDa (MW of target protein)
-
Pathways
- EGFR Signaling Pathway
Target
-