FAM54A antibody (Middle Region)

Catalog No. ABIN632084

The Rabbit Polyclonal anti-FAM54A antibody has been validated for WB. It is suitable to detect FAM54A in samples from Human.

Quick Overview for FAM54A antibody (Middle Region) (ABIN632084)

Target: FAM54A (Family with Sequence Similarity 54, Member A (FAM54A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM54A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM54A Antibody

Binding Specificity: Middle Region

Specificity: FAM54 A antibody was raised against the middle region of FAM54

Purification: Affinity purified

Immunogen: FAM54 A antibody was raised using the middle region of FAM54 corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM54A Blocking Peptide, (ABIN5613491), is also available for use as a blocking control in assays to test for specificity of this FAM54A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM54A

Target: FAM54A (Family with Sequence Similarity 54, Member A (FAM54A))

Alternative Name: FAM54A

Background: FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known.

Molecular Weight: 43 kDa (MW of target protein)