CNN1 antibody (N-Term)

Catalog No. ABIN632093

The Rabbit Polyclonal anti-CNN1 antibody has been validated for WB. It is suitable to detect CNN1 in samples from Human, Rat and Mouse.

Quick Overview for CNN1 antibody (N-Term) (ABIN632093)

Target: CNN1 (Calponin 1 (CNN1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CNN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CNN1 Antibody

Binding Specificity: N-Term

Specificity: Calponin 1 antibody was raised against the N terminal of CNN1

Purification: Affinity purified

Immunogen: Calponin 1 antibody was raised using the N terminal of CNN1 corresponding to a region with amino acids MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calponin 1 Blocking Peptide, catalog no. 33R-6495, is also available for use as a blocking control in assays to test for specificity of this Calponin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CNN1

Target: CNN1 (Calponin 1 (CNN1))

Alternative Name: Calponin 1

Background: CNN1 is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.

Molecular Weight: 33 kDa (MW of target protein)