THG1L antibody

Catalog No. ABIN632108

Product Details anti-THG1L Antibody

Target: THG1L (tRNA-Histidine Guanylyltransferase 1-Like (THG1L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This THG1L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: THG1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

THG1L Blocking Peptide, catalog no. 33R-1871, is also available for use as a blocking control in assays to test for specificity of this THG1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for THG1L

Target: THG1L (tRNA-Histidine Guanylyltransferase 1-Like (THG1L))

Alternative Name: THG1L (THG1L Products)

Synonyms: ICF45 antibody, IHG-1 antibody, 1700121M19Rik antibody, 5730409G07Rik antibody, AA387658 antibody, tRNA-histidine guanylyltransferase 1 like antibody, tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) antibody, tRNA-histidine guanylyltransferase 1-like antibody, THG1L antibody, Thg1l antibody

Background: THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.

Molecular Weight: 35 kDa (MW of target protein)