CCDC69 antibody (Middle Region)

Catalog No. ABIN632117

The Rabbit Polyclonal anti-CCDC69 antibody has been validated for WB. It is suitable to detect CCDC69 in samples from Human.

Quick Overview for CCDC69 antibody (Middle Region) (ABIN632117)

Target: CCDC69 (Coiled-Coil Domain Containing 69 (CCDC69))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC69 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCDC69 Antibody

Binding Specificity: Middle Region

Specificity: CCDC69 antibody was raised against the middle region of CCDC69

Purification: Affinity purified

Immunogen: CCDC69 antibody was raised using the middle region of CCDC69 corresponding to a region with amino acids TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC69 Blocking Peptide, (ABIN5612714), is also available for use as a blocking control in assays to test for specificity of this CCDC69 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC69 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC69

Target: CCDC69 (Coiled-Coil Domain Containing 69 (CCDC69))

Alternative Name: CCDC69

Background: The function of CCDC69 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 35 kDa (MW of target protein)