IMPA1 antibody (Middle Region)

Catalog No. ABIN632122

Product Details anti-IMPA1 Antibody

Target: IMPA1 (Inositol(myo)-1(or 4)-Monophosphatase 1 (IMPA1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IMPA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IMPA1 antibody was raised against the middle region of IMPA1

Purification: Affinity purified

Immunogen: IMPA1 antibody was raised using the middle region of IMPA1 corresponding to a region with amino acids IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IMPA1 Blocking Peptide, catalog no. 33R-4209, is also available for use as a blocking control in assays to test for specificity of this IMPA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IMPA1

Target: IMPA1 (Inositol(myo)-1(or 4)-Monophosphatase 1 (IMPA1))

Alternative Name: IMPA1 (IMPA1 Products)

Synonyms: zgc:100926 antibody, 2610002K09Rik antibody, 2900059K10Rik antibody, AI325909 antibody, IMP antibody, IMPA antibody, impa antibody, inositol monophosphatase 1 antibody, inositol(myo)-1(or 4)-monophosphatase 1 antibody, inositol (myo)-1(or 4)-monophosphatase 1 antibody, inositol monophosphatase antibody, inositol(myo)-1(or 4)-monophosphatase 1 S homeolog antibody, impa1 antibody, Impa1 antibody, IMPA1 antibody, impa1.S antibody

Background: IMPA1 is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. IMPA1 can use myo-inositol monophosphates, myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.

Molecular Weight: 30 kDa (MW of target protein)