MAGEA6 antibody (Middle Region)
-
- Target See all MAGEA6 Antibodies
- MAGEA6 (Melanoma Antigen Family A, 6 (MAGEA6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAGEA6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAGEA6 antibody was raised against the middle region of MAGEA6
- Purification
- Affinity purified
- Immunogen
- MAGEA6 antibody was raised using the middle region of MAGEA6 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSD
- Top Product
- Discover our top product MAGEA6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAGEA6 Blocking Peptide, catalog no. 33R-1419, is also available for use as a blocking control in assays to test for specificity of this MAGEA6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEA6 (Melanoma Antigen Family A, 6 (MAGEA6))
- Alternative Name
- MAGEA6 (MAGEA6 Products)
- Background
- MAGEA6 gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls.
- Molecular Weight
- 35 kDa (MW of target protein)
-