CCT8 antibody

Catalog No. ABIN632135

The Rabbit Polyclonal anti-CCT8 antibody has been validated for WB. It is suitable to detect CCT8 in samples from Human, Mouse, Rat and Dog.

Quick Overview for CCT8 antibody (ABIN632135)

Target: CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCT8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCT8 Antibody

Purification: Affinity purified

Immunogen: CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCT8 Blocking Peptide, (ABIN937462), is also available for use as a blocking control in assays to test for specificity of this CCT8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCT8

Target: CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))

Alternative Name: CCT8

Background: As a molecular chaperone, CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.

Molecular Weight: 59 kDa (MW of target protein)