SFRP2 antibody (Middle Region)
-
- Target See all SFRP2 Antibodies
- SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SFRP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SFRP2 antibody was raised against the middle region of SFRP2
- Purification
- Affinity purified
- Immunogen
- SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
- Top Product
- Discover our top product SFRP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFRP2 Blocking Peptide, catalog no. 33R-2142, is also available for use as a blocking control in assays to test for specificity of this SFRP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))
- Alternative Name
- SFRP2 (SFRP2 Products)
- Synonyms
- frp-2 antibody, sarp1 antibody, sdf-5 antibody, sfrp-2 antibody, SFRP2 antibody, sfrp2 antibody, FRP-2 antibody, SARP1 antibody, SDF-5 antibody, AI851596 antibody, Sdf5 antibody, hm:zeh0225 antibody, zeh0225 antibody, zgc:153618 antibody, SFRP-2 antibody, secreted frizzled-related protein 2 antibody, secreted frizzled related protein 2 antibody, secreted frizzled-related protein 2 S homeolog antibody, secreted frizzled-related protein antibody, sfrp2 antibody, sfrp2 antibody, SFRP2 antibody, sfrp2.S antibody, LOAG_01461 antibody, Sfrp2 antibody
- Background
- SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.
- Molecular Weight
- 31 kDa (MW of target protein)
- Pathways
- WNT Signaling, Tube Formation, Positive Regulation of Endopeptidase Activity, Negative Regulation of intrinsic apoptotic Signaling, Positive Regulation of fat Cell Differentiation
-