PRMT7 antibody (N-Term)

Catalog No. ABIN632137

This Rabbit Polyclonal antibody specifically detects PRMT7 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PRMT7 antibody (N-Term) (ABIN632137)

Target: PRMT7 (Protein Arginine Methyltransferase 7 (PRMT7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRMT7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PRMT7 Antibody

Binding Specificity: N-Term

Specificity: PRMT7 antibody was raised against the N terminal of PRMT7

Purification: Affinity purified

Immunogen: PRMT7 antibody was raised using the N terminal of PRMT7 corresponding to a region with amino acids MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRMT7 Blocking Peptide, (ABIN5615569), is also available for use as a blocking control in assays to test for specificity of this PRMT7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRMT7

Target: PRMT7 (Protein Arginine Methyltransferase 7 (PRMT7))

Alternative Name: PRMT7

Background: Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing.

Molecular Weight: 78 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization