Lipase I antibody (Middle Region)

Catalog No. ABIN632150

Product Details anti-Lipase I Antibody

Target: Lipase I (LIPI)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Lipase I antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LIPI antibody was raised against the middle region of LIPI

Purification: Affinity purified

Immunogen: LIPI antibody was raised using the middle region of LIPI corresponding to a region with amino acids YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIPI Blocking Peptide, catalog no. 33R-10099, is also available for use as a blocking control in assays to test for specificity of this LIPI antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Lipase I

Target: Lipase I (LIPI)

Alternative Name: LIPI (LIPI Products)

Synonyms: CT17 antibody, LPDL antibody, PLA1C antibody, lipi antibody, lpdl antibody, lpdlr antibody, pla1b antibody, pred5 antibody, mpa-pla1 antibody, D930038D03Rik antibody, lpd1 antibody, Liph antibody, lipase I antibody, lipase, member H antibody, lipase, member I antibody, LIPI antibody, liph antibody, Lipi antibody

Background: The protein encoded by this gene is a phospholipase that hydrolyzes phosphatidic acid to produce lysophosphatidic acid. The encoded protein, which can be inhibited by sodium vanadate, may be found exclusively in sperm. Defects in this gene are a cause of susceptibility to familial hypertrigliceridemia.

Molecular Weight: 55 kDa (MW of target protein)