FAM82A1 antibody (Middle Region)

Catalog No. ABIN632156

The Rabbit Polyclonal anti-FAM82A1 antibody has been validated for WB. It is suitable to detect FAM82A1 in samples from Human, Mouse and Rat.

Quick Overview for FAM82A1 antibody (Middle Region) (ABIN632156)

Target: FAM82A1 (RMDN2) (Regulator of Microtubule Dynamics 2 (RMDN2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM82A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM82A1 Antibody

Binding Specificity: Middle Region

Specificity: FAM82 A antibody was raised against the middle region of Fam82

Purification: Affinity purified

Immunogen: FAM82 A antibody was raised using the middle region of Fam82 corresponding to a region with amino acids RAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLPEEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM82A Blocking Peptide, (ABIN5613506), is also available for use as a blocking control in assays to test for specificity of this FAM82A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM82A1

Target: FAM82A1 (RMDN2) (Regulator of Microtubule Dynamics 2 (RMDN2))

Alternative Name: FAM82A

Background: FAM82A belongs to the FAM82/RMD family. It is a single-pass membrane protein. The function of the FAM82A protein remains unknown.

Molecular Weight: 65 kDa (MW of target protein)