LIX1 antibody

Catalog No. ABIN632169

This anti-LIX1 antibody is a Rabbit Polyclonal antibody detecting LIX1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for LIX1 antibody (ABIN632169)

Target: LIX1 (Lix1 Homolog (LIX1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIX1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LIX1 Antibody

Purification: Affinity purified

Immunogen: LIX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIX1 Blocking Peptide, (ABIN5614472), is also available for use as a blocking control in assays to test for specificity of this LIX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIX1

Target: LIX1 (Lix1 Homolog (LIX1))

Alternative Name: LIX1

Background: The function of LIX1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 32 kDa (MW of target protein)